1. art and entertainment
2. visual art and design
3. design

%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 1 of 40
Solicitation X1270003P1
Design and Engineering Services - Port Everglades Slip 1
Expansion
Bid designation: Public
Broward County Board of County Commissioners
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 2 of 40
Bid X1270003P1
Design and Engineering Services - Port Everglades Slip 1 Expansion
Bid Number
X1270003P1
Bid Title
Design and Engineering Services - Port Everglades Slip 1 Expansion
Bid Start Date
In Held
Bid End Date
Apr 13, 2015 5:00:00 PM EDT
Question & Answer
End Date
Apr 1, 2015 5:00:00 PM EDT
Bid Contact
Jeannette Ferrell
Purchasing
954-468-3517
[email protected]
Contract Duration
5 years
Contract Renewal
2 annual renewals
Prices Good for
Not Applicable
Bid Comments
Scope of Work7KH%URZDUG&RXQW\6HDSRUW(QJLQHHULQJDQG&RQVWUXFWLRQ'LYLVLRQLVVROLFLWLQJSURSRVDOVWR
HQJDJHWKHVHUYLFHVRIDTXDOLILHGILUPWRSURYLGHSURIHVVLRQDOGHVLJQDQGHQJLQHHULQJFRQVXOWLQJVHUYLFHVIRU
the expansion of Port Everglades Slip 1. In accordance with the 2014 Port Everglades Master/Vision Plan, Slip
ZLOOEHZLGHQHGE\DSSUR[LPDWHO\IHHW7KHSURSRVHGH[SDQVLRQZLOOZLGHQ6OLSE\FRQVWUXFWLQJDQHZ
south bulkhead in Slip1 (Berths 9 and 10) approximately 175 feet south of its present location and require the
temporary relocation of petroleum offloading facilities. In addition to the bulkhead and marine infrastructure
design, the design will require the integration of removal and disposal of privately owned, currently
RSHUDWLRQDOSHWUROHXPIDFLOLWLHVWKDWVHUYH%HUWKVDQG
7KLVVROLFLWDWLRQLQFOXGHVSDUWLFLSDWLRQJRDOVIRU%URZDUG&RXQW\FHUWLILHG&RXQW\%XVLQHVV(QWHUSULVHV
Refer to Special Instructions and the Office of Economic and Small Business Development section for
additonal information.
Questions and Answers7KH&RXQW\LVQRWREOLJDWHGWRUHVSRQGWRDQ\TXHVWLRQVUHFHLYHGDIWHUWKHOLVWHG
GHDGOLQH9HQGRUVDUHUHTXLUHGWRVXEPLWTXHVWLRQVWKURXJKWKH4XHVWLRQDQG$QVZHU6HFWLRQDYDLODEOHLQ
BidSync).
Item Response Form
Item
X1270003P1--01-01 - Design and Engineering Services
Quantity
1 contract
Prices are not requested for this item.
Delivery Location
Broward County Board of County Commissioners
PRT013
PORT EVERGLADES - SEAPORT
ENGINEERING & CONSTRUCTION
(954) 523-3404
1850 ELLER DRIVE 5TH FLOOR
FORT LAUDERDALE FL 33316
Qty 1
Description
This solicitation is pursuant to Florida Statutes, Chapter 287.055 (Consultants¶&RPSHWLWLYH1HJRWLDWLRQ$FWWKHUHIRUHSULFHZLOOQRWEHFRQVLGHUHGLQWKH
final evaluation and rating of qualified firms.
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 3 of 40
SCOPE OF WORK
Design and Engineering Services - Port Everglades Slip 1 Expansion
The Consultant will be tasked to provide professional design and engineering services
for the expansion of Slip 1 at Port Everglades. In accordance with the 2014 Port
Everglades Master/Vision Plan, Slip 1 will be widened by approximately 175 feet. The
proposed expansion will widen Slip 1 by constructing a new south bulkhead in Slip1
(Berths 9 and 10) approximately 175 feet south of its present location and require the
temporary relocation of petroleum offloading facilities. In addition to the bulkhead and
marine infrastructure design, the design will require the integration of removal and
disposal of privately owned, currently operational petroleum facilities that serve Berths 9
and 10.
The Consultant is expected to provide all engineering or specialty consultant services
(through either in-house or sub-consultant firms) as required to complete the project.
Project services may also include project team facilitation support, project status
reporting, performance/compliance reporting, and presentations to the Port Director’s
office, Port Clients, Petroleum Sector Industry or other audiences as directed.
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 4 of 40
Standard Instructions for Vendors
Request for Letters of Interest, Request for Proposals, or Request for Qualifications
Vendors are instructed to read and follow the instructions carefully, as any misinterpretation or
failure to comply with instructions may lead to a Vendor¶s submittal being rejected.
A. Responsiveness Criteria:
In accordance with Broward County Procurement Code Section 21.8.b.65, a Responsive Bidder
[Vendor] means a person who has submitted a proposal which conforms in all material respects to
a solicitation. The solicitation submittal of a responsive Vendor must be submitted on the required
forms, which contain all required information, signatures, notarizations, insurance, bonding, security,
or other mandated requirements required by the solicitation documents to be submitted at the time
of proposal opening.
Failure to provide the information required below at the time of submittal opening may result in a
recommendation Vendor is non-responsive by the Director of Purchasing. The Selection or
Evaluation Committee will determine whether the firm is responsive to the requirements specified
herein. The County reserves the right to waive minor technicalities or irregularities as is in the best
interest of the County in accordance with Section 21.30.f.1(c) of the Broward County Procurement
Code.
Below are standard responsiveness criteria; refer to Special Instructions to Vendors, for
Additional Responsiveness Criteria requirement(s).
1. Lobbyist Registration Requirement Certification
Refer to Lobbyist Registration Requirement Certification . The completed form should
be submitted with the solicitation response but must be submitted within three business days
of County¶VUHTXHVW9HQGRUPD\EHGHHPHGQRQ-responsive for failure to fully comply within
VWDWHGWLPHIUDPHV
2. Addenda
The County reserves the right to amend this solicitation prior to the due date. Any change(s)
to this solicitation will be conveyed through the written addenda process. Only written
addenda will be binding. If a ³must´addendum is issued, Vendor must follow instructions and
submit required information, forms, or acknowledge addendum, as instructed therein. It is the
responsibility of all potential Vendors to monitor the solicitation for any changing information,
prior to submitting their response.
B. Responsibility Criteria:
Definition of a Responsible Vendor: In accordance with Section 21.8.b.64 of the Broward County
Procurement Code, a Responsible Vendor means a Vendor who has the capability in all respects to
perform the contract requirements, and the integrity and reliability which will assure good faith
performance.
The Selection or Evaluation Committee will recommend to the awarding authority a determination of
a Vendor¶s responsibility. At any time prior to award, the awarding authority may find that a Vendor is
not responsible to receive a particular award.
Failure to provide any of this required information and in the manner required may result in a
recommendation by the Director of Purchasing that the Vendor is non-responsible.
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Below are standard responsibility criteria; refer to Special Instructions to Vendors, for Additional
Responsibility Criteria requirement(s).
Exhibit 1
Page 5 of 40
1. /LWLJDWLRQ+LVWRU\
a. All Vendors are required to disclose to the County all "material" cases filed, pending, or
resolved during the last three (3) years prior to the solicitation response due date, whether
such cases were brought by or against the Vendor, any parent or subsidiary of the Vendor, or
any predecessor organization.
b. For each material case, the Vendor is required to provide all information identified on the
Litigation History Form.
c.
The County will consider a Vendor's litigation history information in its review and
determination of responsibility.
d. If the Vendor is a joint venture, the information provided should encompass the joint venture
and each of the entities forming the joint venture.
e. A Vendor is also required to disclose to the County any and all case(s) that exist between the
County and any of the Vendor's subcontractors/subconsultants proposed to work on this
project.
f. Failure to disclose any material case, or to provide all requested information in connection
with each such case, may result in the Vendor being deemed non-UHVSRQVLYH
2. )LQDQFLDO,QIRUPDWLRQ
a. All Vendors are required to provide the Vendor's financial statements at the time of submittal
in order to demonstrate the Vendor's financial capabilities.
b. Each Vendor shall submit its most recent two years of financial statements for review. The
ILQDQFLDOVWDWHPHQWVDUHQRWUHTXLUHGWREHDXGLWHGILQDQFLDOVWDWHPHQWV7KHDQQXDOILQDQFLDO
VWDWHPHQWVZLOOEHLQWKHIRUPRI
i.
ii.
iii.
Balance sheets, income statements and annual reports; or
Tax returns; or
6(&ILOLQJV
c. If a Vendor has been in business for less than the number of years of required financial
statements, then the Vendor must disclose all years that the Vendor has been in business,
including any partial year-to-date financial statements.
d. The County may consider the unavailability of the most recent year¶s financial statements and
whether the Vendor acted in good faith in disclosing the financial documents in its
HYDOXDWLRQ
e. Any claim of confidentiality on financial statements should be asserted at the time of
submittal. Refer to Standard Instructions to Vendors, Public Records and Exemptions
and to Submission of Sealed Submittals for instructions on submitting confidential financial
statements. The Vendor¶s failure to provide the information as instructed may lead to the
LQIRUPDWLRQEHFRPLQJSXEOLF
f. Although the review of a Vendor's financial information is an issue of responsibility, the failure
to either provide the financial documentation or correctly assert a confidentiality claim
pursuant the Florida Public Records Law and the solicitation requirements (Public Record
30
S
%URZDUG&RXQW\%RDUGRI
%LG;3
&RXQW\&RPPLVVLRQHUV
p
q
(
and Exemptions section) may result in a recommendation of non-responsiveness by the
Director of Purchasing.
Exhibit 1
Page 6 of 40
3. Authority to Conduct Business in Florida
a. A Vendor must have the authority to transact business in the State of Florida and be in good
standing with the Florida Secretary of State. For further information, contact the Florida
Department of State, Division of Corporations.
b. The County will review the Vendor¶s business status based on the information provided in
response to this solicitation.
c. It is the Vendor¶s responsibility to comply with all state and local business requirements.
d. Vendor should list its active Florida Department of State Division of Corporations Document
Number (or Registration No. for fictitious names) in the Vendor Questionnaire, Question
1R
e. If a Vendor is an out-of-state or foreign corporation or partnership, the Vendor must obtain the
authority to transact business in the State of Florida or show evidence of application for the
authority to transact business in the State of Florida, upon request of the County.
f. A Vendor that is not in good standing with the Florida Secretary of State at the time of a
submission to this solicitation may be deemed non-UHVSRQVLEOH
g. If successful in obtaining a contract award under this solicitation, the Vendor must remain in
good standing throughout the contractual period of performance.
C. Additional Information and Certifications
The following forms and supporting information (if applicable) should be returned with Vendor¶s
VXEPLWWDO,IQRWSURYLGHGZLWKVXEPLWWDOWKH9HQGRUPXVWVXEPLWZLWKLQWKUHHEXVLQHVVGD\VRI
County¶s request. Failure to timely submit may affect Vendor¶s evaluation.
1. Vendor Questionnaire
Vendor is required to submit detailed information on their firm. Refer to the Vendor
Questionnaire DQGVXEPLWDVLQVWUXFWHG
2. Standard Certifications
Vendor is required to certify to the below requirements. Refer to the Standard Certifications
and submit as instructed.
a.
b.
c.
d.
e.
Cone of Silence Requirement Certification
Drug-Free Workplace Certification
Non-Collusion Certification
Public Entities Crimes Certification
Scrutinized Companies List Certification
3. Subcontractors/Subconsultants/Suppliers Requirement
The Vendor shall submit a listing of all subcontractors and major material suppliers, if any,
and the portion of the contract they will perform. Vendors must follow the instructions
included on the Subcontractors/Subconsultants/Suppliers Requirement Form and
VXEPLWDVLQVWUXFWHG
D. Standard Agreement Language Requirements
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
1. The acceptance of or any exceptions taken to the terms and conditions of the County ¶s
Agreement shall be considered a part of a Vendor¶s submittal and will be considered by the
Selection or Evaluation Committee.
Exhibit 1
Page 7 of 40
2. The applicable Agreement terms and conditions for this solicitation are indicated in the Special
Instructions to Vendors.
3. Vendors are required to review the applicable terms and conditions and submit the Agreement
Exception Form. If the Agreement Exception Form is not provided with the submittal, it shall
be deemed an affirmation by the Vendor that it accepts the Agreement terms and conditions as
disclosed in the solicitation.
4. If exceptions are taken, the Vendor must specifically identify each term and condition with which it
LVWDNLQJDQH[FHSWLRQ$Q\H[FHSWLRQQRWVSHFLILFDOO\OLVWHGLVGHHPHGZDLYHG6LPSO\LGHQWLI\LQJ
a section or article number is not sufficient to state an exception. Provide either a redlined
version of the specific change(s) or specific proposed alternative language. Additionally, a brief
justification specifically addressing each provision to which an exception is taken should be
provided.
5. Submission of any exceptions to the Agreement does not denote acceptance by the County.
Furthermore, taking exceptions to the County¶s terms and conditions may be viewed unfavorably
by the Selection or Evaluation Committee and ultimately may impact the overall evaluation of a
Vendor¶s submittal.
E. Insurance Requirements
The Insurance Requirement Form reflects the insurance requirements deemed necessary for this
project. It is not necessary to have this level of insurance in effect at the time of submittal, but it is
necessary to submit certificates indicating that the Vendor currently carries the insurance or to
submit a letter from the carrier indicating it can provide insurance coverages.
F. Evaluation Criteria
1. Vendors are evaluated as per the Evaluation Criteria. The County reserves the right to obtain
additional information from Vendors.
2. Vendors have a continuing obligation to provide the County with any material changes to the
information requested.
3. For Request for Proposals, points for each Evaluation Criteria is identified in the solicitation;
DYDLODEOHSRLQWVWRWDOVWRSRLQWV
4. For Request for Proposals that include a request for pricing, the total points awarded for price is
determined by applying the following formula:
(Lowest Proposed Price/Vendor¶s Price) x (Maximum Number of Points for Price) = Price
Score
5. Prices may be negotiated in the best interest of the County after the scoring is completed.
G. Demonstrations
If applicable, as indicated in Special Instructions to Vendors, Vendors will be required to
demonstrate the nature of their offered solution. After receipt of submittals, all Vendors will receive a
description of, and arrangements for, the desired demonstration. A copy of the demonstration (hard
30
S
%URZDUG&RXQW\%RDUGRI
%LG;3
&RXQW\&RPPLVVLRQHUV
p
g
py
(
copy, DVD, CD, flash drive or a combination of both) should be given to the Purchasing Agent at the
demonstration meeting to retain in the Purchasing files.
Exhibit 1
Page 8 of 40
H. Presentations
If applicable, as indicated in Special Instructions to Vendors, all Vendors that are found to be both
responsive and responsible to the requirements of the solicitation will have an opportunity to make
an oral presentation to the Selection or Evaluation Committee on the Vendor¶s approach to this
project and the Vendor¶VDELOLW\WRSHUIRUP7KHFRPPLWWHHPD\SURYLGHDOLVWRIVXEMHFWPDWWHUIRU
the discussion. All Vendor¶s will have equal time to present but the question-and-answer time may
YDU\
I. Public Art and Design Program
If indicated in Special Instructions to Vendors, Public Art and Design Program, Section 1-88,
Broward County Code of Ordinances, applies to this project. It is the intent of the County to
functionally integrate art, when applicable, into capital projects and integrate artists¶design concepts
into this improvement project. The Vendor may be required to collaborate with the artist(s) on design
development within the scope of this request. Artist(s) shall be selected by Broward County through
an independent process. For additional information, contact the Broward County Cultural Division.
J. Committee Appointment
The Cone of Silence shall be in effect for County staff at the time of the Selection or Evaluation
Committee appointment and for County Commissioners and Commission staff at the time of the
Shortlist Meeting of the Selection Committee or the Initial Evaluation Meeting of the Evaluation
Committee. The committee members appointed for this solicitation are available on the Purchasing
Division¶s website under Committee Appointment.
K. Committee Questions, Request for Clarifications, Additional Information
At any committee meeting, the Selection or Evaluation Committee members may ask questions,
request clarification, or require additional information of any Vendor¶s submittal or proposal. It is not
mandatory for Vendors to attend committee meetings; however it is highly recommended Vendors
attend to answer any committee questions (if requested) including a representative of the Vendor
that has the authority to bind.
Vendor¶s answers may impact evaluation (and scoring, if applicable). Upon written request to the
Purchasing Agent prior to the meeting, a conference call number will be made available for Vendors
to participate via teleconference. Only Vendors that are found to be both responsive and responsible
to the requirements of the solicitation are requested to participate in a final (or presentation)
Selection or Evaluation committee meeting.
L. Vendor Questions
Any questions concerning the instructions, specifications, or requirements of this solicitation shall be
directed in writing to the Purchasing Division by the deadline listed in the solicitation. Vendors should
submit questions regarding this solicitation through the ³Q&A´section on BidSync. Questions will be
routed to the Purchasing Agent for review; answers will be posted through BidSync or through an
addendum issued through BidSync. No interpretation(s) shall be considered binding unless provided
WRDOO9HQGRUVLQZULWLQJ
M. Public Records and Exemptions
1. Broward County is a public agency subject to Chapter 119, Florida Statutes. Upon receipt, all
response submittals become "public records" and shall be subject to public disclosure
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
p
p
consistent with Chapter 119, Florida Statutes.
%LG;3
j
p
Exhibit 1
Page 9 of 40
2. Any Vendor that intends to assert any materials to be exempted from public disclosure under
Chapter 119, Florida Statutes must submit the document(s) in a separate document labeled
"Name of Vendor, Attachment to Proposal Package, Solicitation No. # - Confidential Matter."
The Vendor must identify the specific statute and subsection that authorizes the exemption
from the Public Records law. CD/DVD discs or flash drives included in the submittal must
also comply with this requirement and separate any files claimed to be confidential.
3. Failure to provide this information at the time of submittal and in the manner required above
may result in a recommendation by the Director of Purchasing that the Vendor is nonresponsive.
4. Except for the materials submitted in compliance with the forgoing, any claim of confidentiality
on materials that the Vendor asserts to be exempt and placed elsewhere in the submittal will
be considered waived by the Vendor.
5. Submitting confidential material may impact full discussion of your submittal by the Selection
or Evaluation Committee because the Committee will be unable to talk about the details of
WKHFRQILGHQWLDOPDWHULDOVDWWKHSXEOLF6XQVKLQHPHHWLQJ
N. Copyrighted Materials
Copyrighted material is not exempt from the Public Records Law, Chapter 119, Florida Statutes.
Copyrighted material will be accepted as part of a submittal only if accompanied by a waiver that will
allow the County to make paper and electronic copies necessary for the use of County staff and
agents. Therefore, such material will be subject to viewing by the public, but copies of the material
will not be provided to the public.
O. State and Local Preferences
If the solicitation involves a federally funded project where the fund requirements prohibit the use of
VWDWHDQGRUORFDOSUHIHUHQFHVVXFKSUHIHUHQFHVFRQWDLQHGLQWKH/RFDO3UHIHUHQFH2UGLQDQFH
and Broward County Procurement Code will not be applied in the procurement process.
P. Local Preference
Except where otherwise prohibited by federal or state law or other funding source restrictions, a
local Vendor whose submittal is within 5% of the highest total ranked Vendor outside of the
preference area will become the Vendor with whom the County will proceed with negotiations for a
final contract. Refer to Local Vendor Certification Form (Preference and Tiebreaker) for further
information.
Q. Tiebreaker Criteria
In accordance with Section 21.31.d of the Broward County Procurement Code, the tiebreaker criteria
shall be applied based upon the information provided in the Vendor's response to the solicitation. In
order to receive credit for any tiebreaker criterion, complete and accurate information must be
contained in the Vendor¶VVXEPLWWDO
1. Local Vendor Certification Form (Preference and Tiebreaker);
2. Domestic Partnership Act Certification (Requirement and Tiebreaker);
3. Tiebreaker Criteria Form: Volume of Work Over Five Years
R. Posting of Solicitation Results and Recommendations
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
The Broward County Purchasing Division's website is the location for the County's posting of all Page 10 of 40
solicitations and contract award results. It is the obligation of each Vendor to monitor the website in
RUGHUWRREWDLQFRPSOHWHDQGWLPHO\LQIRUPDWLRQ
S. Review and Evaluation of Responses
A Selection or Evaluation Committee is responsible for recommending the most qualified Vendor(s).
The process for this procurement may proceed in the following manner:
1. The Purchasing Division delivers the solicitation submittals to agency staff for summarization for
the committee members. Agency staff prepares a report, including a matrix of responses
submitted by the Vendors. This may include a technical review, if applicable.
2. Staff identifies any incomplete responses. The Director of Purchasing reviews the information
and makes a recommendation to the Selection or Evaluation Committee as to each Vendor¶s
responsiveness to the requirements of the solicitation. The final determination of responsiveness
UHVWVVROHO\RQWKHGHFLVLRQRIWKHFRPPLWWHH
3. At any time prior to award, the awarding authority may find that a Vendor is not responsible to
receive a particular award. The awarding authority may consider the following factors, without
limitation: debarment or removal from the authorized Vendors list or a final decree, declaration or
order by a court or administrative hearing officer or tribunal of competent jurisdiction that the
Vendor has breached or failed to perform a contract, claims history of the Vendor, performance
history on a County contract(s), an unresolved concern, or any other cause under this code and
Florida law for evaluating the responsibility of an Vendor.
T. Vendor Protest
Sections 21.118 and 21.120 of the Broward County Procurement Code set forth procedural
requirements that apply if a Vendor intends to protest a solicitation or proposed award of a contract
and state in part the following:
1. Any protest concerning the solicitation or other solicitation specifications or requirements
must be made and received by the County within seven business days from the posting of
the solicitation or addendum on the Purchasing Division¶s website. Such protest must be
made in writing to the Director of Purchasing. Failure to timely protest solicitation
specifications or requirements is a waiver of the ability to protest the specifications or
requirements.
2. Any protest concerning a solicitation or proposed award above the award authority of the
Director of Purchasing, after the RLI or RFP opening, shall be submitted in writing and
received by the Director of Purchasing within five business days from the posting of the
recommendation of award on the Purchasing Division's website.
3. Any actual or prospective Vendor who has a substantial interest in and is aggrieved in
connection with the proposed award of a contract which does not exceed the amount of the
award authority of the Director of Purchasing, may protest to the Director of Purchasing. The
protest shall be submitted in writing and received within three (3) business days from the
posting of the recommendation of award on the Purchasing Division's website.
4. For purposes of this section, a business day is defined as Monday through Friday between
8:30 a.m. and 5:00 p.m. Failure to timely file a protest within the time prescribed for a
proposed contract award shall be a waiver of the Vendor's right to protest.
5. Protests arising from the decisions and votes of a Selection or Evaluation Committee shall be
limited to protests based upon the alleged deviations from established committee
30
S
%URZDUG&RXQW\%RDUGRI
%LG;3
&RXQW\&RPPLVVLRQHUV
p
p
g
Exhibit 1
procedures set forth in the Broward County Procurement Code and existing written Page 11 of 40
guidelines. Any allegations of misconduct or misrepresentation on the part of a competing
Vendor shall not be considered a protest.
6. As a condition of initiating any protest, the protestor shall present the Director of Purchasing a
nonrefundable filing fee in accordance with the table below.
(VWLPDWHG&RQWUDFW$PRXQW)LOLQJ)HH
$30,000 -
$250,001 -
$500,001 -PLOOLRQ
2YHUPLOOLRQ
If no contract proposal amount was submitted, the estimated contract amount shall be the
County¶s estimated contract price for the project. The County may accept cash, money
order, certified check, or cashier ¶s check, payable to Broward County Board of
Commissioners.
U. Right of Appeal
Pursuant to Section 21.83.d of the Broward County Procurement Code, any Vendor that has a
substantial interest in the matter and is dissatisfied or aggrieved in connection with the Selection or
Evaluation Committee¶s determination of responsiveness may appeal the determination pursuant to
Section 21.120 of the Broward County Procurement Code.
1. The appeal must be in writing and sent to the Director of Purchasing within ten (10) calendar
days of the determination by the Selection or Evaluation Committee to be deemed timely.
2. As required by Section 21.120, the appeal must be accompanied by an appeal bond by a
Vendor having standing to protest and must comply with all other requirements of this
section.
3. The institution and filing of an appeal is an administrative remedy to be employed prior to the
institution and filing of any civil action against the County concerning the subject matter of the
appeal.
V. Rejection of Responses
The Selection or Evaluation Committee may recommend rejecting all submittals as in the best
interests of the County. The rejection shall be made by the Director of Purchasing, except when a
solicitation was approved by the Board, in which case the rejection shall be made by the Board.
W. Negotiations
The County intends to conduct the first negotiation meeting no later than two weeks after approval of
the final ranking as recommended by the Selection or Evaluation Committee. At least one of the
representatives for the Vendor participating in negotiations with the County must be authorized to
bind the Vendor. In the event that the negotiations are not successful within a reasonable timeframe
(notification will be provided to the Vendor) an impasse will be declared and negotiations with the
first-ranked Vendor will cease. Negotiations will begin with the next ranked Vendor, etc. until such
time that all requirements of Broward County Procurement Code have been met.
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 12 of 40
Special Instructions to Vendors
Solicitation Name: Design DQG Engineering Services – Port Everglades Slip 1 Expansion
Vendors are instructed to read and follow the instructions carefully, as any misinterpretation or
failure to comply with instructions may lead to a Vendor’s submittal being rejected.
A. Additional Responsiveness Criteria:
In addition to the requirements set forth in the Standard Instructions to Vendors, the following
criteria shall also be evaluated in making a determination of responsiveness:
1. Employment Eligibility Verification Program Requirement (State funding)
Refer to Employment Eligibility Verification Program Requirement Form and submit as
instructed.
B. Additional Responsibility Criteria:
In addition to the requirements set forth in the Standard Instructions to Vendors, the following
criteria shall also be evaluated in making a determination of responsibility:
1. Office of Economic and Small Business Development Program
This solicitation has the following County Business Enterprise Goals: 18% CBE Goals.
Vendors must follow the instructions included in the Office of Economic and Small
Business Development Requirements section and submit all required forms and
information as instructed.
2. Additional Requirement(s)
Certifications:
Proposers must provide evidence that, at the time of their submittal, they are certified under
Section 471.023, Florida Statutes to practice or to offer to practice engineering; or certified
under Section 472.021, Florida Statutes to practice or offer to practice surveying and
mapping. Certifications should be submitted with the proposal, but must be provided within
three (3) business days of being requested by the County.
C. Standard Agreement Language Requirements:
The applicable Agreement terms and conditions for this solicitation can be located at:
http://www.broward.org/Purchasing/Documents/Ecf202.pdf
Refer to Standard Instructions for Vendors and the requirements to review the applicable
terms and conditions (and submission of the Agreement Exception Form).
D. Demonstrations:
Not applicable to this solicitation.
E. Presentations:
Not applicable to this solicitation.
F. Public Art and Design Program:
Not applicable to this solicitation.
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 13 of 40
G. Procurement Authority:
Non-Continuing Contract: Professional services needed for a construction project where the
construction costs exceed $ 325,000 pursuant to Florida Statutes, Chapter 287.055
Consultants’ Competitive Negotiation Act (CCNA).
H. Project Funding Source - this project is funded in whole or in part by:
County Funds and Florida Department of Transportation (FDOT)
I.
Projected Schedule:
Initial Shortlisting or Evaluation Meeting (Sunshine Meeting):
Final Evaluation Meeting (Sunshine Meeting):
Check this website for any changes to the above tentative schedule for Sunshine Meetings:
http://www.broward.org/Commission/Pages/SunshineMeetings.aspx.
J. Project Manager Information:
Project Manager: Gary Bogumill, Project Manager III
Email: [email protected]
Vendors are required to submit questions regarding this solicitation through the “Q&A” section
on BidSync. Answers will be posted through BidSync.
K. Submittal Instructions:
1. Vendor should submit seven (7) total printed copies (hard copies) of its response and ten(10)
CDs or flash drives of its response. Submittals should be clearly labeled with Vendor Name,
Solicitation Number (X1270003P1) and Project Title (Design DQG Engineering 6ervices3RUW
(YHUJODGHV6OLS([SDQVLRQ'RQRWVXEPLWUHVSRQVHWKURXJK%LG6\QF
2. Vendor should provide responses to the Evaluation Criteria, Questions 1 through 7, in
numeric sequence; and in both Microsoft Word and PDF formats on the CDs or flash drives.
3. Vendor must refer to Submission of Sealed Submittals for detailed submittal instructions.
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 14 of 40
Evaluation Criteria
Design and Engineering Services – Port Everglades Slip 1 Expansion
1. Ability of Professional Personnel:
Describe the qualifications and relevant experience of the Project Manager and all key staff that
are intended to be assigned to this project. Include resumes for the Project Manager and all key
staff described. Include the qualifications and relevant experience of all subconsultants’ key staff
to be assigned to this project.
Additional Instructions: Provide a comprehensive organizational chart including all members
of the proposed project team. i.e., Land Surveying, Geotechnical Engineering, Civil Engineering,
Transportation and Traffic Engineering, Environmental, Structural Engineering, Mechanical
Engineering, Electrical Engineering, Telecommunications and Data Engineering, and related
services.
Maximum Points Value: 15
Click here to enter a brief summary of response and/or reference the page/section of firm’s
detailed response in the hardcopy submittal.
2. Project Approach:
Describe the prime Vendor’s approach to the project. Include how the prime Vendor will use
subconsultants in the project.
Additional Instructions: Describe comparable experience within the past 10 years
coordinating a broad based multi-disciplined project working with multiple diverse stakeholders
in developing an overall project plan including environmental design, engineering and
construction which provided the ability to maintain continuity of operations during the
implementation.
Maximum Points Value: 20
Click here to enter a brief summary of response and/or reference the page/section of firm’s
detailed response in the hardcopy submittal.
3. Past Performance: Describe prime Vendor’s experience on projects of similar nature, scope
and duration, along with evidence of satisfactory completion, both on time and within budget, for
the past five years. A minimum of three references should be provided for the projects
identified. References and performance evaluations will be considered in evaluation of Vendor’s
past performance.
3.1. Describe the firm’s qualifications or relevant experience in the design/operation of deepwater petroleum terminals or refinery facilities including loading arm, manifold
systems and piping facilities.
a. List the responsibilities of key personnel on all petroleum related projects.
b. Provide details of what was designed and what company or companies were served
by the facilities.
c. List references of experience working with major oil companies.
Maximum Points Value: 20
Click here to enter a brief summary of response and/or reference the page/section of firm’s
detailed response in the hardcopy submittal.
3.2. Describe the firm’s qualifications or relevant experience in the design of deep-water port
facilities, specifically combi-wall and reconstruction projects
a. For each project describe the type of wall, proposed dredge depth, type of anchor
system and intended vessel size.
b. List key personnel on each project and their role on that project.
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 15 of 40
c. Describe the firm’s experience in permitting marine reconstruction projects in Florida.
Maximum Points Value: 10
Click here to enter a brief summary of response and/or reference the page/section of firm’s
detailed response in the hardcopy submittal.
3.3. Describe the firm’s experience in the design of mooring and fendering systems.
a. For each project describe the capacity of the bollards, type of bollard foundations and
type of fenders.
b. For each project list the size and displacement of target vessels.
c. Describe the program the firm uses for mooring analysis.
Maximum Points Value: 5
Click here to enter a brief summary of response and/or reference the page/section of firm’s
detailed response in the hardcopy submittal.
3.4. Describe the firm’s experience remediation of contaminated sites including assessment,
permitting and removal and disposal of petroleum contaminated soils.
a. List key personnel and their role in the projects as well as their projected role in this
project.
b. Describe the firms experience in permitting remediation or Superfund site projects.
c. Provide a list of permits for remediation, Superfund, Brownfield and marine
construction projects processed in the last 5 years.
Maximum Points Value: 10
Click here to enter a brief summary of response and/or reference the page/section of firm’s
detailed response in the hardcopy submittal.
3.5. Describe the firm’s qualifications or relevant experience in the design of cathodic
protection systems to protect deep-water marine structures.
a. Provide details on each project on the type of wall protected.
b. State if the design was for a new or existing wall.
c. Type of anodes used.
d. State whether the system was fully designed or was bid as a performance
specification.
Maximum Points Value: 5
Click here to enter a brief summary of response and/or reference the page/section of firm’s
detailed response in the hardcopy submittal.
4. Workload of the Firm:
For the prime Vendor only, list all completed and active projects that Vendor has managed
within the past five years. In addition, list all projected projects that Vendor will be working on in
the near future. Projected projects will be defined as a project(s) that Vendor is awarded a
contract but the Notice to Proceed has not been issued. Identify any projects that Vendor
worked on concurrently. Describe Vendor’s approach in managing these projects. Were there
or will there be any challenges for any of the listed projects? If so, describe how Vendor dealt or
will deal with the projects’ challenges.
Maximum Points Value: 5
Click here to enter a brief summary of response and/or reference the page/section of firm’s
detailed response in the hardcopy submittal.
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 16 of 40
5. Location:
Refer to Vendor’s Business Location Attestation Form and submit as instructed.
A Vendor with a principal place of business location (also known as the nerve center) within
Broward County will receive five points; a Vendor not having a principal place of business in
Broward County will receive zero points. The following applies for a Vendor responding as a
Joint Venture (JV): if a member of the JV has 51% or more of the equity and it’s principal place
of business is within Broward County, the JV will receive three points; if a member of the JV has
30 to 50% of the equity and its principal place of business is within Broward County, the JV will
receive two points; and if a member of the JV has 10% to 29% of the equity of its principal place
of business is within Broward County, the JV will receive one point.
Maximum Points Value: 5
6. Willingness to Meet Time and Budget Requirements:
State the Vendor’s willingness to meet the project’s completion date requirement and
willingness to keep project total costs below the project budget.
Completion Date Requirement: Subject to project schedule and phases, up to five years.
Project Budget: Estimated $4,500,000
Maximum Points Value: 2 (Yes = 2 / No = 0)
Yes
No
7. Volume of Previous Work:
Refer to Volume of Previous Work Attestation Form and the Volume of Previous Work
Attestation Joint Venture Form and submit as instructed.
Maximum Points Value (Dollar volume for prime Vendor ONLY will be determined by the
Purchasing Division): 3 Points ($0 - $3,000,000); 2 Points ($3,000,001 - $7,500,000); 1 Points
($7,500,001 - $10,000,000); 0 Points (Over $10,000,000).
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 17 of 40
Submission of Sealed Submittals
Request for Letters of Interest, Request for Proposals, or Request for Qualifications
1. Vendor should submit the number of printed copies and electronic copies (CD/DVD/flash drive)
as requested, per Special Instructions to Vendors for this solicitation. Electronic response
should contain a single PDF file that contains your entire response with each page of the
response in the order as presented in the solicitation document, including any attachments.
CD/DVDs/Flash drives included in the submittal must be finalized or closed so that no changes
can be made to the contents of the files. Electronic submission of submittal does not eliminate
the required printed copies of solicitation.
2. It is the responsibility of the Vendor to assure that the information submitted in both its hardcopy
written response and electronic responses are consistent and accurate. If there is a
GLVFUHSDQF\WKHLQIRUPDWLRQSURYLGHGLQWKHZULWWHQUHVSRQVHVKDOOJRYHUQ
3. Confidential information on CD/DVD/flash drive (i.e. financial statements), must be submitted in a
separate bound document labeled "Name of Vendor, Attachment to Proposal Package,
SOLICITATION# - Confidential Matter". The Vendor must identify the specific section of the
Florida Statutes that authorizes the exemption from the Public Records Law. CD/DVDs/flash
drives included in the submittal must also comply with this requirement and separate any
PDWHULDOVFODLPHGWREHFRQILGHQWLDO&RQILGHQWLDOLQIRUPDWLRQVKRXOGQRWEHVXEPLWWHGWKURXJK
BidSync.
4. It is important that each CD/DVD/flash drive be labeled with the Vendor name, solicitation number
and title, and placed in an individual disc envelope (if CD/DVD).
5. The Purchasing Division must receive hardcopy and electronic submittals no later than 5:00 pm
on required due date. Purchasing will not accept late or misdirected submittals. If fewer than
three Vendors respond to this solicitation, the Director of Purchasing may extend the deadline for
submittal by up to four (4) weeks. Submittals will only be opened following the final submittal due
date.
6. Send all printed solicitation submittals to:
Broward County Purchasing Division
115 South Andrews Avenue, Room 212
Fort Lauderdale, FL 33301
5H6ROLFLWDWLRQ1XPEHU
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 18 of 40
LOBBYIST REGISTRATION REQUIREMENT CERTIFICATION FORM
The completed form should be submitted with the solicitation response but must be submitted within
three business days of County¶s request. Vendor may be deemed non-responsive for failure to fully
comply within stated timeframes.
The Vendor certifies that it understands if it has retained a lobbyist(s) to lobby in connection with a
competitive solicitation, it shall be deemed non-responsive unless the firm, in responding to the
competitive solicitation, certifies that each lobbyist retained has timely filed the registration or
amended registration required under Broward County Lobbyist Registration Act, Section 1-262,
Broward County Code of Ordinances; and it understands that if, after awarding a contract in
connection with the solicitation, the County learns that the certification was erroneous, and upon
investigation determines that the error was willful or intentional on the part of the Vendor, the County
may, on that basis, exercise any contractual right to terminate the contract for convenience.
The Vendor hereby certifies that: (select one)
,WKDVQRWUHWDLQHGDOREE\LVWVWROREE\LQFRQQHFWLRQZLWKWKLVFRPSHWLWLYHVROLFLWDWLRQ
however, if retained after the solicitation, the County will be notified.
,WKDVUHWDLQHGDOREE\LVWVWROREE\LQFRQQHFWLRQZLWKWKLVFRPSHWLWLYHVROLFLWDWLRQDQG
certified that each lobbyist retained has timely filed the registration or amended registration
required under Broward County Lobbyist Registration Act, Section 1-262, Broward County
Code of Ordinances.
It is a requirement of this solicitation that the names of any and all lobbyists retained to lobby
in connection with this solicitation be listed below:
Authorized
Signature/Name
30
Print Name of Lobbyist
Print Lobbyist¶s Firm
Print Name of Lobbyist
Print Lobbyist¶s Firm
Title
Vendor Name
Date
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 19 of 40
EMPLOYMENT ELIGIBILITY VERIFICATION PROGRAM
REQUIREMENT CERTIFICATION FORM
The completed and signed form should be returned with the Vendor¶s submittal. If not provided with submittal, the Vendor
must submit within three business days of County¶s request. Vendor may be deemed non-responsive for failure to fully
comply within stated timeframes.
The State of Florida, Executive Order 11-116, requires Broward County, as a party to any State‐ funded contracts, to
participate in the Employment Eligibility Verification administered by the U.S. Department of Homeland Security (³DHS
Any Vendor performing work pursuant to the State funded contract issued by the County is required to use the E-Verify
Program to confirm employment eligibility of its current and prospective employees. The undersigned Vendor hereby
certifies that it will enroll and participate in the E-Verify Program, in accordance with the terms and conditions governing the
use of the program by:
(1) Verifying the employment eligibility of all persons employed during the contract term by the contractor to perform the
work under this contract.
(2) Enrolling in the E-Verify Program within thirty (30) days of the effective date of this contract by obtaining a copy of the
³Edit Company Profile´page and make such record available to within seven days of request from the County.
(3) Requiring all persons, including subcontractors, assigned by the Contractor to perform work under this contract to enroll
and participate in the E-Verify Program within ninety (90) days of the effective date of this contract or within ninety (90)
days of the effective date of the contract between the Contractor and the subcontractor, whichever is later. The
Contractor shall obtain from the subcontractor a copy of the ³Edit Company Profile´screen indicating enrollment in the
E-Verify Program and make such record available to the County within seven calendar days from the County¶s request.
(4) Displaying the notices supplied by DHS in a prominent place that is clearly visible to prospective employees and all
employees who are to be verified through the system.
(5) Initiate E-Verify verification procedures for new employees within 3 business days after the actual work start date of
each new hire and thereafter shall respond appropriately to any additional requests from DHS or Social Security
Administration (SSA).
(6) Maintain records of its participation and compliance with the provisions of the E-Verify Program and make such records
available within seven days of County¶s request.
AUTHORIZED SIGNATURE/ NAME
30
TITLE
COMPANY
DATE
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 20 of 40
DOMESTIC PARTNERSHIP ACT CERTIFICATION FORM (REQUIREMENT AND TIEBREAKER)
Refer to Special Instructions to identify if Domestic Partnership Act is a requirement of the solicitation or acts only as a
tiebreaker. If Domestic Partnership is a requirement of the solicitation, the completed and signed form should be returned
with the Vendor¶s submittal. If the form is not provided with submittal, the Vendor must submit within three business days of
County¶s request. Vendor may be deemed non-responsive for failure to fully comply within stated timeframes. To qualify for
the Domestic Partnership tiebreaker criterion, the Vendor must currently offer the Domestic Partnership benefit and the
completed and signed form must be returned at time of solicitation submittal.
7KH'RPHVWLF3DUWQHUVKLS$FW6HFWLRQò-157, Broward County Code of Ordinances, requires all Vendors contracting
with the County, in an amount over $100,000 provide benefits to Domestic Partners of its employees, on the same basis as
it provides benefits to employees¶spouses, with certain exceptions as provided by the Ordinance.
For all submittals over $100,000.00, the Vendor, by virtue of the signature below, certifies that it is aware of the
requirements of Broward County¶s Domestic Partnership Act, Section 16-ò-157, Broward County Code of Ordinances;
and certifies the following: (check only one below).
1.
The Vendor currently complies with the requirements of the County¶s Domestic Partnership
Act and provides benefits to Domestic Partners of its employees on the same basis as it
provides benefits to employees¶spouses.
2.
The Vendor will comply with the requirements of the County¶s Domestic Partnership Act at
time of contract award and provide benefits to Domestic Partners of its employees on the
same basis as it provides benefits to employees¶spouses.
3.
The Vendor will not comply with the requirements of the County ¶s Domestic Partnership Act at
time of award.
4.
The Vendor does not need to comply with the requirements of the County ¶s Domestic
Partnership Act at time of award because the following exception(s) applies: (check only one
below).
The Vendor employs less than five (5) employees.
The Vendor is a governmental entity, not-for-profit corporation, or charitable organization.
The Vendor is a governmental entity, not-for-profit corporation, or charitable organization.
The Vendor does not provide benefits to employees¶spouses.
The Vendor provides an employee the cash equivalent of benefits. (Attach an affidavit in
compliance with the Act stating the efforts taken to provide such benefits and the amount of
the cash equivalent).
The Vendor cannot comply with the provisions of the Domestic Partnership Act because it
would violate the laws, rules or regulations of federal or state law or would violate or be
inconsistent with the terms or conditions of a grant or contract with the United States or State
of Florida. Indicate the law, statute or regulation (State the law, statute or regulation and
attach explanation of its applicability).
Authorized Signature/Name
30
Title
9HQGRU1DPH
Date
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 21 of 40
Office of Economic and Small Business Requirements: CBE Goal Participation
A. In accordance with Broward County Business Opportunity Act of 2012, Ordinance No. 2012-33, Broward County Code of Ordinances,
the County Business Enterprise (CBE) Program is applicable to this contract. All Vendors responding to this solicitation should utilize,
or attempt to utilize, CBE firms to perform at least the assigned participation goal for this contract.
B. CBE Program Requirements: Compliance with CBE participation goal requirements is a matter of responsibility; required forms and
information should be submitted with solicitation submittal. If not provided with solicitation submittal, the Vendor must supply information
within three business days of the Office of Economic and Small Business Development¶s (OESBD) request. Vendor may be deemed
non-responsible for failure to fully comply within stated timeframes.
1. Vendor should include in its solicitation submittal a Letter Of Intent Between Bidder/Offeror and County Business
Enterprise (CBE) Subcontractor/Supplier, for each certified CBE firm the Vendor intends to use to achieve the assigned
&%(SDUWLFLSDWLRQJRDO
2. If a Vendor is unable to attain the CBE participation goal, the Vendor should include in its solicitation submittal Application for
Evaluation of Good Faith Effort and all of the required supporting information.
C. The Vendor shall only address the base solicitation amount for CBE goal participation. No alternate/optional item(s) shall be addressed.
If the County chooses to exercise the right to award alternate/optional solicitation item(s), the CBE participation goal for this solicitation
shall apply to the alternate/optional item(s) recommended to be awarded. The County shall issue a notice to the apparent successful
Vendor requiring the Vendor to comply with the CBE participation goal for the alternate/optional item(s); Vendor shall submit all required
IRUPVSULRUWRDZDUG)DLOXUHWRVXEPLWWKHUHTXLUHGIRUPVPD\UHVXOWLQUHMHFWLRQRIWKHVROLFLWDWLRQ
D. The Office of Economic and Small Business Development maintains an on-line directory of CBE firms. The on-line directory is available
for use by Vendors at https://bcegov3.broward.org/SmallBusiness/SBDirectory.aspx
E. For detailed information regarding the County Business Enterprise Program contact the Office of Economic and Small Business
Development at (954) 357-RUYLVLWWKHZHEVLWHDWKWWSZZZEURZDUGRUJ(FRQ'HY6PDOO%XVLQHVV
F. Requirements for Contracts with CBE Goals: if awarded the contract, the Vendor agrees to and shall comply with all applicable
UHTXLUHPHQWVRIWKH&%(3URJUDPLQWKHDZDUGDQGDGPLQLVWUDWLRQRIWKHFRQWUDFW
1. No party to this contract may discriminate on the basis of race, color, sex, religion, national origin, disability, age, marital status,
SROLWLFDODIILOLDWLRQVH[XDORULHQWDWLRQSUHJQDQF\RUJHQGHULGHQWLW\DQGH[SUHVVLRQLQWKHSHUIRUPDQFHRIWKLVFRQWUDFW
2. Vendor shall comply with all applicable requirements of the Broward County Small Business Development Program in the award
DQGDGPLQLVWUDWLRQRIWKLVFRQWUDFW)DLOXUHE\9HQGRUWRFDUU\RXWDQ\RIWKHVHUHTXLUHPHQWVVKDOOFRQVWLWXWHDPDWHULDOEUHDFKRI
this contract, which shall permit County to terminate this contract or to exercise any other remedy provided under this contract,
under the Broward County Code of Ordinances, or Administrative Code, or under applicable law, with all of such remedies being
FXPXODWLYH
3. Vendor shall pay its CBE subcontractors and suppliers, within fifteen (15) days following receipt of payment from County for such
subcontracted work and pay all other subcontractors and suppliers within thirty (30) days following receipt of payment from
County for such subcontracted work or supplies. If Vendor withholds an amount from CBE subcontractors or suppliers as
retainage, such retainage shall be released and paid within fifteen (15) days following receipt of payment of retained amounts
from County. For all other subcontractors or suppliers, if Vendor withholds an amount as retainage, such retainage shall be
released and paid within thirty (30) days following receipt of payment of retained amounts from County.
4. Vendor understands that the County will monitor compliance with the CBE requirements. Vendor must report monthly on its CBE
SDUWLFLSDWLRQFRPPLWPHQWZLWKLWVSD\UHTXHVWVDQGLVUHTXLUHGDVDFRQGLWLRQRISD\PHQW
30
S
S
S
S \
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
T
T
%LG;3
Exhibit 1
Page 22 of 40
S \
LETTER OF INTENT BETWEEN BIDDER/OFFEROR AND COUNTY BUSINESS ENTERPRISE (CBE)
SUBCONTRACTOR/SUPPLIER
This form(s) should be returned with the Vendor¶s submittal. If not provided with solicitation submittal, the Vendor
must supply information within three business days of County¶s request. This form is to be completed and signed
IRUHDFK&%(ILUP9HQGRUVKRXOGVFDQDQGXSORDGWKHFRPSOHWHGVLJQHGIRUPVLQ%LG6\QF
Solicitation Number: X1270003P1
Project Title: Design and Engineering Services - Port Everglades
Slip 1 Expansion
Bidder/Offeror Name:
Address:
City:
State:
Authorized Representative:
Zip:
Phone:
CBE Subcontractor/Supplier Name:
Address:
City:
State:
Authorized Representative:
A.
B.
C.
D.
Zip:
Phone:
This is a letter of intent between the bidder/offeror on this project and a CBE firm for the CBE to perform
subcontracting work on this project.
By signing below, the bidder/offeror is committing to utilize the above-named CBE to perform the work
described below.
By signing below, the above-named CBE is committing to perform the work described below.
By signing below, the bidder/offeror and CBE affirm that if the CBE subcontracts any of the work described
below, it may only subcontract that work to another CBE.
Work to be performed by CBE Firm
De scr ipt ion
NAICS
*
CBE Co ntract Amou nt
‚
CBE Percentage of
Total Project Value
AFFIRMATION: I he reby affirm that the informat ion abo ve is true and corre ct.
CBE Subcontract or/Supplier Authorized Rep resen tati ve
(Signature)
(Title)
(Dat e)
(Title)
(Dat e)
Bidde r/Offe ror Authorized Repre se ntati ve
(Signature)
* Visit http://www.census.gov/eos/www/naics/ to search. Match type of work with NAICS code as closely as
possible.
‚To be provided only when the solicitation requires that bidder/offer include a dollar amount in its bid-offer.
In th e e vent th e b idder/offero r do es no t re c e ive a ward o f t he pri me contra c t, a ny an d a ll repres ent at ion s in th is L e tter of In te n t an d Affir mat ion s hall b e
null an d vo id.
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
APPLICATION FOR EVALUATION OF GOOD FAITH EFFORT
PURSUANT TO BUSINESS OPPORTUNITY ACT OF 2012, Sec. 1-81.5(e)
%LG;3
Exhibit 1
Page 23 of 40
If applicable, this form and supporting documentation should be returned with the Vendor ¶s
submittal. If not provided with solicitation submittal, the Vendor must supply information within three
business days of County¶s request. Vendor should scan and upload the supporting documentation
in BidSync.
SOLCITATION NO.:
X1270003P1
PROJECT NAME:
Design and Engineering
Services - P o r t
Everglades Slip 1
Expansion
PRIME CONTRACTOR
ADDRESS
TELEPHONE
The undersigned representative of the prime contractor represents that his/her firm has
contacted County Business Enterprise (CBE) certified firms in a good faith effort to meet
the CBE goal for this solicitation but has not been able to meet the goal. Consistent with the
requirements of the Business Opportunity Act o f 2012 (the A ct), the p rime contractor
hereby submits documentation (attached to this form) of good faith efforts made and
requests to be evaluated under Section 1-81.5(e) of the Act.
The prime contractor understands that a determination of good faith effort to meet the CBE
contract participation goal is contingent on both the information provided by the prime
contractor as an attachment to this application and the other factors listed in Section 1-81.5
HRIWKH&%($FWDVWKRVHIDFWRUVDUHDSSOLFDEOHZLWKUHVSHFWWRWKLVVROLFLWDWLRQ7KH
prime contractor acknowledges that the determination of good faith effort is made by the
Director of the Office of Economic and Small Business Development, and is not subject to
appeal.
S IGNATURE:
P RINT NAME / TITLE:
DATE:
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 24 of 40
LOCAL VENDOR CERTIFICATION FORM (PREFERENCE AND TIEBREAKER)
The completed and signed form should be returned with the Vendor͛s submittal to qualify for Local
Preference, however it must be returned at time of solicitation submittal to qualify for the Tie Break
ĐƌŝƚĞƌŝĂ͘/ĨŶŽƚƉƌŽǀŝĚĞĚǁŝƚŚƐƵďŵŝƚƚĂů͕ƚŚĞsĞŶĚŽƌŵƵƐƚƐƵďŵŝƚǁŝƚŚŝŶƚŚƌĞĞďƵƐŝŶĞƐƐĚĂLJƐŽĨ
County͛s request for evaluation of Local Preference. Proof of a local business tax must be returned at
time of solicitation submittal to qualify for the Tie Break criteria. Failure to timely submit this form or
local business tax receipt may render the business ineligible for application of the Local Preference.
Failure to timely submit this form or local business tax receipt at time of submittal will disqualify the
Vendor for this Tie Breaker.
In accordance with Section 21.31.d. of the Broward County Procurement Code, to qualify for the Tie
Break Criteria, the undersigned Vendor hereby certifies that (check box if applicable):
The Vendor is a local Vendor in Broward County and:
a.
has a valid Broward County local business tax receipt;
b.
has been in existence for at least six-months prior to the solicitation opening;
c.
provides services on a day-to-day basis, at a business address physically located within the
ůŝŵŝƚƐŽĨƌŽǁĂƌĚŽƵŶƚLJĂŶĚŝŶĂŶĂƌĞĂnjŽŶĞĚĨŽƌƐƵĐŚďƵƐŝŶĞƐƐ͖ĂŶĚ
d.
services provided from this location are a substantial component of the services offered in
the Vendor's proposal.
In accordance with Local Preference, Section 1-74, et. seq., Broward County Code of Ordinances, and
Broward County͛s Interlocal Reciprocity Agreement with Miami-ĂĚĞŽƵŶƚLJ͕ĂůŽĐĂůďƵƐŝŶĞƐƐŵĞĞƚŝŶŐ
the below requirements is eligible for Local Preference. To qualify for the Local Preference, the
undersigned Vendor hereby certifies that (check box if applicable):
The Vendor is a local Vendor in Broward County and:
a.
has a valid corresponding County local business tax receipt;
b.
has been in existence for at least one-year prior to the solicitation opening;
c.
provides services on a day-to-day basis, at a business address physically located within the
ůŝŵŝƚƐŽĨƌŽǁĂƌĚŽƌDŝĂŵŝ-Dade County and in an area zoned for such business; and
d.
the services provided from this location are a substantial component of the services offered
in the Vendor's proposal.
Vendor does not qualify for Tie Break Criteria or Local Preference, in accordance with the
above requirements.
AUTHORIZED SIGNATURE/ NAME
30
TITLE
COMPANY
DATE
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 25 of 40
VOLUME OF PREVIOUSLY WORK ATTESTATION FORM
The completed and signed form should be returned with the Vendor¶s submittal. If not provided with submittal,
the Vendor must submit within three business days of County¶s request. Failure to provide timely may affect the
Vendor¶s evaluation. This completed form must be included with the Vendor¶s submittal at the time of the
opening deadline to be considered for a Tie Breaker criterion (if applicable).
The calculation for Volume of Previous Work is all amounts paid to the prime Vendor by Broward County Board
of County Commissioners at the time of the solicitation opening date within a five-year timeframe. The
calculation of Volume of Previous Work for a prime Vendor previously awarded a contract as a member of a
Joint Venture firm is based on the actual equity ownership of the Joint Venture firm.
In accordance with Section 21.31.d. of the Broward County Procurement Code, the Vendor with the lowest
dollar volume of work previously paid by the County over a five-year period from the date of the submittal
opening will receive the Tie Breaker.
Vendor must list all projects it received payment from Broward County Board of County Commissioners during
the past five years. If the Vendor is submitting as a joint venture, the information provided should encompass the
joint venture and each of the entities forming the joint venture. The Vendor attests to the following:
Item
No.
Project Title
Solicitation/
Contract
Number:
Department or
Division
Date
Awarded
Paid to Date
Dollar Amount
1
2
3
4
5
Grand Total
+DVWKH9HQGRUEHHQDPHPEHUSDUWQHURID-RLQW9HQWXUHILUPWKDWZDVDZDUGHGDFRQWUDFWE\WKH&RXQW\"
<HV 1R
If Yes, Vendor must submit a Joint Vendor Volume of Work Attestation Form.
9HQGRU1DPH
Authorized Signature/ Name
30
Title
Date
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 26 of 40
VOLUME OF PREVIOUS WORK ATTESTATION JOINT VENTURE FORM
If applicable, this form and additional required documentation should be submitted with the Vendor¶s submittal. If
not provided with submittal, the Vendor must submit within three business days of County¶s request. Failure to
timely submit this form and supporting documentation may affect the Vendor¶s evaluation.
The calculation of Volume of Previous Work for a prime Vendor previously awarded a contract as a member of a
Joint Venture firm is based on the actual equity ownership of the Joint Venture firm. Volume of Previous Work is
QRWEDVHGWKHWRWDOSD\PHQWVWRWKH-RLQW9HQWXUHILUP
Vendor must list all projects it received payment from Broward County Board of County Commissioners during
the past five years as a member of a Joint Venture. The Vendor attests to the following:
Item
No.
Project Title
Solicitation/
Contract
Number:
Department
or Division
Date
Awarded
JV
Equity
%
Paid to Date
Dollar
Amount
1
2
3
4
5
Grand Total
Vendor is required to submit an executed Joint Venture agreement(s) and any amendments for each project
listed above. Each agreement must be executed prior to the opening date of this solicitation.
9HQGRU1DPH
Authorized Signature/ Name
30
Title
Date
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 27 of 40
LITIGATION HISTORY FORM
The completed form(s) should be returned with the Vendor¶s submittal. If not provided with submittal, the Vendor
must submit within three business days of County¶s request. Vendor may be deemed non-responsive for failure to
fully comply within stated timeframes.
There are no material cases for this Vendor; or
Material Case(s) are disclosed below:
Is this for a: (check type)
3DUHQW Subsidiary, or
Predecessor Firm?
Party
If Yes, Name of Parent/Subsidiary/Predecessor:
RU1R
Vendor is Plaintiff
9HQGRULV'HIHQGDQW
Case Number, Name,
and Date Filed
Name of Court or other tribunal
Type of Case
Bankruptcy
&LYLO
&ULPLQDO
$GPLQLVWUDWLYH5HJXODWRU\
Claim or Cause of Action and
Brief description of each Count
Brief description of the
Subject Matter and Project
Involved
Disposition of Case
Pending
(Attach copy of any applicable
Judgment, Settlement
Agreement and Satisfaction of
Judgment.)
Settled
Judgment Vendor¶s Favor
Dismissed
-XGJPHQW$JDLQVW9HQGRU
If Judgment Against, is Judgment Satisfied? Yes
1R
Name:
Opposing Counsel
Email:
Telephone Number:
Vendor Name:
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 28 of 40
AGREEMENT EXCEPTION FORM
The completed form(s) should be returned with the Vendor¶s submittal. If not provided with submittal, it shall be
deemed an affirmation by the Vendor that it accepts the terms and conditions of the County¶s Agreement as disclosed
in the solicitation.
The Vendor must either provide specific proposed alternative language on the form below. Additionally, a brief
justification specifically addressing each provision to which an exception is taken should be provided.
There are no exceptions to the terms and conditions of the County Agreement as referenced in the
solicitation; or
The following exceptions are disclosed below: (use additional forms as needed; separate each
Article/ Section number)
Term or Condition
Article / Section
Insert version of exception or specific
proposed alternative language
Provide brief justification for
change
Vendor Name:
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 29 of 40
VENDOR'S BUSINESS LOCATION ATTESTATION FORM
The completed and signed form and supporting information (if applicable, for Joint Ventures) should
be returned with the Vendor¶VVXEPLWWDO,IQRWSURYLGHGZLWKVXEPLWWDOWKH9HQGRUPXVWVXEPLW
within three business days of County¶VUHTXHVW)DLOXUHWRWLPHO\VXEPLWWKLVIRUPDQGVXSSRUWLQJ
information may affect the Vendor¶s evaluation.
Vendor Name:
The Vendor attests that it understands the County¶s definition of a local business is as defined by the
Broward County Local Preference Ordinance, ³Principal place of business means the nerve center
RUFHQWHURIRYHUDOOGLUHFWLRQFRQWURODQGFRRUGLQDWLRQRIWKHDFWLYLWLHVRIWKHELGGHU,IWKHELGGHUKDV
only one (1) business location, such business location shall be considered its principal place of
business.´ The Vendor further attests that it understands that as defined by the US Supreme Court
³principal place of business is best read as referring to the place where a corporation's officers
direct, control, and coordinate the corporation's activities. It is the place that Courts of Appeals have
called the corporation's µnerve center¶and in practice it should normally be the place where the
corporation maintains its headquarters; provided that the headquarters is the actual center of
direction, control, and coordination, i.e., the µnerve center¶, and not simply an office where the
corporation holds its board meetings (for example, attended by directors and officers who have
traveled there for the occasion).´
The Vendor also attests to the following:
1. Vendor¶VDGGUHVVOLVWHGLQLWVSURSRVDOLV
2. Vendor¶s address as listed in the Florida Department of State Division of Corporations is:
3. If these two addresses are the same, this business address is the ³nerve center´for the
Vendor.
4. If these two addresses are not same, the Vendor attests that the following business address
is the ³nerve center´IRUWKH9HQGRU
5. Vendor has been located at the listed ³nerve center´address for at least six (6) months prior
to the opening date of this solicitation, which is:
6. If the Vendor has not been located at the address listed in #5 for at least six (6) months prior to
the opening date of this solicitation, the following address is the previous business location:
7. Vendor has not merged with another firm that is not headquartered in Broward County and is
not a wholly owned subsidiary or a holding company of another firm that is not headquartered
in Broward County.
8. If awarded a contract, it is the intent of the Vendor to remain at the referenced address for the
duration of the contract term, including any renewals, extensions or any approved interim
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
g y
%LG;3
y pp
Exhibit 1
Page 30 of 40
contracts for the services provided under this contract.
9. The Vendor understands that if after awarding a contract in connection with the solicitation, the
County learns that the attestation was erroneous, and upon investigation determines that the
error was willful or intentional on the part of the Vendor, the County may, on that basis,
H[HUFLVHDQ\FRQWUDFWXDOULJKWWRWHUPLQDWHWKHFRQWUDFW)XUWKHUDQ\PLVOHDGLQJLQDFFXUDWH
false information or documentation submitted by any party affiliated with this procurement may
lead to suspension and/or debarment from doing business with Broward County as outlined in
the Procurement Code, Section 21.119.
If the Vendor is submitting a response as a Joint Venture, the following information is required to be
submitted:
1. Name of the Joint Venture Partnership
2. Percentage of Equity for all Joint Venture Partners
3. A copy of the executed Agreement(s) between the Joint Venture Partners
7KHVLJQDWXUHEHORZPXVWEHE\DQLQGLYLGXDOZKRLVDXWKRUL]HGWRELQGWKH9HQGRU<RXUVLJQDWXUH
below is an attestation that all information listed above and provided to Broward County is true and
accurate.
Authorized Signature/Name
30
Title
Vendor Name
Date
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 31 of 40
VENDOR QUESTIONNAIRE FORM
The completed Vendor Questionnaire should be submitted with the solicitation response but must be submitted within
three business days of County¶s request. Failure to timely submit may affect Vendor¶s evaluation.
If a response requires additional information, the Vendor should attach a written detailed response; each
response should be numbered to match the question number. The completed questionnaire and attached
responses will become part of the procurement record. It is imperative that the person completing the Vendor
Questionnaire be knowledgeable about the proposing Vendor¶s business and operations.
1. Legal business name:
2. Federal Employer I.D. no. (FEIN):
Dun and Bradstreet No.:
4. Doing Business As/ Fictitious Name (if applicable):
5. Website address (if applicable):


6. Principal place of business address:


7. Office location responsible for this project:
8. Telephone no.:
)D[QR
9. TYPE OF BUSINESS (check appropriate box):
Corporation (Specify the State of Incorporation):
Sole Proprietor
Limited Liability Corporation
(LLC)
General Partnership (State and County filed in)
Limited Partnership
Other ± Specify
10. List Florida Department of State, Division of Corporations document number (or registration number if fictitious
QDPH
11. List name and title of each principal, owner, officer, and major shareholder:
a)
b)
c)
d)
12. AUTHORIZED CONTACT(S) FOR YOUR FIRM:
Name:
Title:
Telephone Number:
Fax Number:
E-mail:
Name:
30
Title:
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
Telephone Number:
%LG;3
Exhibit 1
Page 32 of 40
Fax Number:
E-mail:
13.
Has your firm ever failed to complete any services and/or delivery of products
GXULQJWKHODVWWKUHH\HDUV"If yes, specify details in an attached written
response.
<HV
No
14.
Is your firm or any of its principals or officers currently principals or officers of
another organization? If yes, specify details in an attached written response.
<HV
No
15.
Have any voluntary or involuntary bankruptcy petitions been filed by or against your
firm, its parent or subsidiaries or predecessor organizations during the last three
years? If yes, specify details in an attached written response.
<HV
No
16.
Has your firm, its principals, officers or predecessor organization(s) been
debarred or suspended by any government entity within the last three years? If
yes, specify details in an attached written response.
<HV
No
17.
Has your firm¶s surety ever intervened to assist in the completion of a contract or
have Performance and/or Payment Bond claims been made to your firm or its
predecessor¶s sureties during the last three years? If yes, specify details in an
attached written response, including contact information for owner and surety.
<HV
No
18.
Has your firm ever failed to complete any work awarded to you, services and/or
delivery of products during the last three (3) years? If yes, specify details in an
attached written response.
<HV
No
19.
Has your firm ever been terminated from a contract within the last three years? If
yes, specify details in an attached written response.
<HV
No
20.
Living Wage solicitations only: In determining what, if any, fiscal impacts(s) are a
result of the Ordinance for this solicitation, provide the following for informational
purposes only. Response is not considered in determining the award of this
FRQWUDFW/LYLQJ:DJHKDGDQHIIHFWRQWKHSULFLQJ
If yes, Living Wage increased the pricing by
by
30
<HV
1$
No
% or decreased the pricing
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 33 of 40
STANDARD CERTIFICATIONS
The completed and acknowledged certifications should be submitted with the solicitation response but must be
submitted within three business days of County¶s request. Failure to timely submit may affect Vendor¶s evaluation.
&RQHRI6LOHQFH5HTXLUHPHQW&HUWLILFDWLRQ
The Cone of Silence Ordinance, Section 1-266, Broward County Code of Ordinances, as amended, prohibits certain
communications among Vendors, Commissioners, County staff, and Selection or Evaluation Committee members.
Identify on a separate sheet any violations of this Ordinance by any members of the responding firm or its joint
venturers. After the application of the Cone of Silence, inquiries regarding this solicitaiton should be directed to the
Director of Purchasing or designee. The Cone of Silence terminates when the County Commission or other awarding
authority takes action which ends the solicitation.
The Vendor hereby certifies that: (check each box)
The Vendor has read Cone of Silence Ordinance, Section 1-266, Broward County Code of Ordinances, as
amended; and
The Vendor understands that the Cone of Silence for this competitive solicitation shall be in effect beginning
upon the appointment of the Selection or Evaluation Committee, for communication regarding this solicitation
with the County Administrator, Deputy and Assistants to the County Administrator and their respective
support staff or any person, including Evaluation or Selection Committee members, appointed to evaluate or
UHFRPPHQGVHOHFWLRQLQWKLV5)35/,SURFHVV)RU&RPPXQLFDWLRQZLWK&RXQW\&RPPLVVLRQHUVDQG
Commission staff, the Cone of Silence allows communication until the initial Evaluation or Selection
Committee Meeting.
The Vendor agrees to comply with the requirements of the Cone of Silence Ordinance.
Drug-Free Workplace Requirements Certification:
Section 21.31.a. of the Broward County Procurement Code requires awards of all competitive solicitations requiring
Board award be made only to firms certifying the establishment of a drug free workplace program. The program must
consist of:
1. Publishing a statement notifying its employees that the unlawful manufacture, distribution, dispensing,
possession, or use of a controlled substance is prohibited in the offeror's workplace, and specifying the actions
that will be taken against employees for violations of such prohibition;
2. Establishing a continuing drug-free awareness program to inform its employees about:
a. The dangers of drug abuse in the workplace;
b. The offeror's policy of maintaining a drug-free workplace;
c. Any available drug counseling, rehabilitation, and employee assistance programs; and
d. The penalties that may be imposed upon employees for drug abuse violations occurring in the workplace;
3. Giving all employees engaged in performance of the contract a copy of the statement required by subparagraph
1;
4. Notifying all employees, in writing, of the statement required by subparagraph 1, that as a condition of
employment on a covered contract, the employee shall:
a. Abide by the terms of the statement; and
b. Notify the employer in writing of the employee's conviction of, or plea of guilty or nolo contendere to, any
violation of Chapter 893 or of any controlled substance law of the United States or of any state, for a violation
occurring in the workplace NO later than five days after such conviction.
5. Notifying Broward County government in writing within 10 calendar days after receiving notice under subdivision
EDERYHIURPDQHPSOR\HHRURWKHUZLVHUHFHLYLQJDFWXDOQRWLFHRIVXFKFRQYLFWLRQ7KHQRWLFHVKDOOLQFOXGH
WKHSRVLWLRQWLWOHRIWKHHPSOR\HH
6. Within 30 calendar days after receiving notice under subparagraph 4 of a conviction, taking one of the following
actions with respect to an employee who is convicted of a drug abuse violation occurring in the workplace:
a. Taking appropriate personnel action against such employee, up to and including termination; or
b. Requiring such employee to participate satisfactorily in a drug abuse assistance or rehabilitation program
approved for such purposes by a federal, state, or local health, law enforcement, or other appropriate
agency; and
7. Making a good faith effort to maintain a drug-free workplace program through implementation of subparagraphs
30
S
g g
1 through 6.
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
g
p
p
%LG;3
g
g
p
p
g p Exhibit 1
Page 34 of 40
The Vendor hereby certifies that: (check box)
9HQGRUFHUWLILHVWKDWLWKDVHVWDEOLVKHGDGUXJIUHHZRUNSODFHSURJUDPLQDFFRUGDQFHZLWKWKHDERYHUHTXLUHPHQWV
Non-Collusion Certification:
Vendor shall disclose, to their best knowledge, any Broward County officer or employee, or any relative of any such
officer or employee as defined in Section 112.3135 (1) (c), Florida Statutes, who is an officer or director of, or has a
PDWHULDOLQWHUHVWLQWKH9HQGRU
VEXVLQHVVZKRLVLQDSRVLWLRQWRLQIOXHQFHWKLVSURFXUHPHQW$Q\%URZDUG&RXQW\
officer or employee who has any input into the writing of specifications or requirements, solicitation of offers, decision
to award, evaluation of offers, or any other activity pertinent to this procurement is presumed, for purposes hereof, to
be in a position to influence this procurement. Failure of a Vendor to disclose any relationship described herein shall be
reason for debarment in accordance with the provisions of the Broward County Procurement Code.
The Vendor hereby certifies that: (select one)
Vendor certifies that this offer is made independently and free from collusion; or
Vendor is disclosing names of officers or employees who have a material interest in this procurement and
is in a position to influence this procurement. Vendor must include a list of name(s), and relationship(s) with
its submittal.
Public Entities Crimes Certification:
In accordance with Public Entity Crimes, Section 287.133, Florida Statutes, a person or affiliate placed on the
convicted vendor list following a conviction for a public entity crime may not submit on a contract: to provide any goods
or services; for construction or repair of a public building or public work; for leases of real property to a public entity;
and may not be awarded or perform work as a contractor, supplier, subcontractor, or consultant under a contract with
any public entity; and may not transact business with any public entity in excess of the threshold amount provided in s.
287.017 for Category Two for a period of 36 months following the date of being placed on the convicted vendor list.
The Vendor hereby certifies that: (check box)
Vendor certifies that no person or affiliates of the Vendor are currently on the convicted vendor list and/or
KDVQRWEHHQIRXQGWRFRPPLWDSXEOLFHQWLW\FULPHDVGHVFULEHGLQWKHVWDWXWHV
Scrutinized Companies List Certification:
Any company, principals, or owners on the Scrutinized Companies with Activities in Sudan List or on the Scrutinized
Companies with Activities in the Iran Petroleum Energy Sector List is prohibited from submitting a response to a
solicitation for goods or services in an amount equal to or greater than $1 million.
The Vendor hereby certifies that: (check each box)
The Vendor, owners, or principals are aware of the requirements of Section 287.135, Florida Statutes,
regarding Companies on the Scrutinized Companies with Activities in Sudan List or on the Scrutinized
Companies with Activities in the Iran Petroleum Energy Sector List; and
The Vendor, owners, or principals, are eligible to participate in this solicitation and are not listed on either
the Scrutinized Companies with Activities in Sudan List or on the Scrutinized Companies with Activities in
the Iran Petroleum Energy Sector List; and
If awarded the Contract, the Vendor, owners, or principals will immediately notify the County in writing if any
of its principals are placed on the Scrutinized Companies with Activities in Sudan List or on the Scrutinized
Companies with Activities in the Iran Petroleum Energy Sector List
I hereby certify the information provided in the Vendor Questionnaire Form and Standard Certifications:
*AUTHORIZED SIGNATURE/NAME
TITLE
DATE
Vendor Name:
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 35 of 40
* I certify that I am authorized to sign this solicitation response on behalf of the Vendor as indicated in Certificate as to Corporate Principal,
designation letter by Director/Corporate Officer, or other business authorization to bind on behalf of the Vendor. As the Vendor¶s authorized
representative, I attest that any and all statements, oral, written or otherwise, made in support of the Vendor ¶s response, are accurate, true
and correct. I also acknowledge that inaccurate, untruthful, or incorrect statements made in support of the Vendor ¶s response may be used
by the County as a basis for rejection, rescission of the award, or termination of the contract and may also serve as the basis for debarment
of Vendor pursuant to Section 21.119 of the Broward County Procurement Code. I certify that the Vendor¶s response is made without prior
understanding, agreement, or connection with any corporation, firm or person submitting a response for the same items/services, and is in
all respects fair and without collusion or fraud. I also certify that the Vendor agrees to abide by all terms and conditions of this solicitation,
acknowledge and accept all of the solicitation pages as well as any special instructions sheet(s).
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 36 of 40
SUBCONTRACTORS/SUBCONSULTANTS/SUPPLIERS INFORMATION FORM
The following forms and supporting information (if applicable) should be returned with Vendor¶VVXEPLWWDO,IQRW
provided with submittal, the Vendor must submit within three business days of County¶s request. Failure to timely
submit may affect Vendor¶s evaluation.
A.
The Vendor shall submit a listing of all subcontractors, subconsultants and major material suppliers (firms),
if any, and the portion of the contract they will perform. A major material supplier is considered any firm
that provides construction material for construction contracts, or commodities for service contracts in
excess of $50,000, to the Vendor.
B.
If participation goals apply to the contract, only non-certified firms shall be identified on the form. A non
certified firm is a firm that is not listed as a firm for attainment of participation goals (ex. County Business
Enterprise or Disadvantaged Business Enterprise), if applicable to the solicitation.
C.
This list shall be kept up-to-GDWHIRUWKHGXUDWLRQRIWKHFRQWUDFW,IVXEFRQWUDFWRUVVXEFRQVXOWDQWVRU
suppliers are stated, this does not relieve the Vendor from the prime responsibility of full and complete
satisfactory performance under any awarded contract.
D.
After completion of the contract/final payment, the Vendor shall certify the final list of non-certified
subcontractors, subconsultants, and suppliers that performed or provided services to the County for the
UHIHUHQFHGFRQWUDFW
If none, state ³none´RQWKLVIRUP8VHDGGLWLRQDOVKHHWVDVQHHGHG
6XEFRQWUDFWHG)LUP¶V1DPH
6XEFRQWUDFWHG)LUP¶V$GGUHVV
6XEFRQWUDFWHG)LUP¶V7HOHSKRQH1XPEHU
&RQWDFW3HUVRQ¶V1DPHDQG3RVLWLRQ
&RQWDFW3HUVRQ¶s E-0DLO$GGUHVV
(VWLPDWHG6XEFRQWUDFW6XSSOLHV&RQWUDFW$PRXQW
7\SHRI:RUN6XSSOLHV3URYLGHG
6XEFRQWUDFWHG)LUP¶V1DPH
6XEFRQWUDFWHG)LUP¶V$GGUHVV
6XEFRQWUDFWHG)LUP¶V7HOHSKRQH1XPEHU
&RQWDFW3HUVRQ¶V1DPHDQG3RVLWLRQ
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 37 of 40
&RQWDFW3HUVRQ¶s E-0DLO$GGUHVV
(VWLPDWHG6XEFRQWUDFW6XSSOLHV&RQWUDFW$PRXQW
7\SHRI:RUN6XSSOLHV3URYLGHG
,FHUWLI\WKDWWKHLQIRUPDWLRQVXEPLWWHGLQWKLVUHSRUWLVLQIDFWWUXHDQGFRUUHFWWRWKHEHVWRIP\NQRZOHGJH
Authorized Signature/Name
30
Title
Vendor Name
Date
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 38 of 40
Port Everglades Security Requirements:
A.
The Department of Port Everglades requires persons to present, at port entry, a valid
driver¶s license and valid reason for wishing to be granted port access in order to obtain
a temporary/visitor ID badge. For persons who will visit the Port more than 15 times in a
90 day period, a permanent identification badge must be obtained and paid for by the
Vendor for all employees, subcontractors, agents and servants visiting or working on
the Port project. A restricted access badge application process will include a
comprehensive background check. Badges must be renewed as required and the fees
paid pursuant to Broward County Administrative Code, Section 42.6. For further
information, please call (954) 765-4225.
B.
All vehicles that are used regularly on the dock apron must have a Dockside Parking
Permit. Only a limited number of permits will be issued per business entity. The fee is
$100.00 per permit/vehicle. Individuals requesting a permit must possess a valid Portissued Restricted Access Area badge with a ³Dock´destination. Requests for Dockside
Parking Permits must be submitted in writing, on Vendor letterhead, to the ID Badge
Office. Applicants must demonstrate a need for access to the dock apron. Requests
shall be investigated, and approved, if appropriate justification is provided. Supporting
GRFXPHQWDWLRQPXVWEHVXSSOLHGLIUHTXHVWHG'RFNSHUPLWVDUHQRWWUDQVIHUDEOHDQG
must be affixed to the lower left corner of the permitted vehicle¶VZLQGVKLHOG6KRXOGWKH
permit holder wish to transfer the permit to another vehicle during the term of issuance,
the permit will be removed and exchanged at no charge for a new permit. Only one
business entity representative will be permitted on the dock at a time at the vessel
location.
C.
The Federal Government has instituted requirements for a Transportation Worker
Identification Credential (TWIC) for all personnel requiring unescorted access to
designated secure areas within Port Everglades. The contractor will be responsible for
complying with the applicable TWIC requirements. For further information, please call 1866-347-8942, or go on line to http://www.tsa.gov/stakeholders/transportation-workeridentification-credential-twic%C2%AE.
30
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
30
%LG;3
Exhibit 1
Page 39 of 40
S
%URZDUG&RXQW\%RDUGRI
&RXQW\&RPPLVVLRQHUV
%LG;3
Exhibit 1
Page 40 of 40
Question and Answers for Bid #X1270003P1 - Design and Engineering Services Port Everglades Slip 1 Expansion
OVERALL BID QUESTIONS
There are no questions associated with this bid.
30
S